The search yielded (5) results
C-Peptide (human); Insulin Precursor (57-87) (human),CAS#: 33017-11-7, Catalog Number: KS031006 This C-peptide measurement can sensitively assess beta-cell functions under standardized conditions, which is the most suitable primary outcome for clinical trials of therapies aimed at preserving or improving preserving endogenous insulin secretion in type 1 diabetes patients. SMILES: OC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H]
Proinsulin C-Peptide (55-89) (human),CAS#: 11097-48-6, Catalog Number: KS031003 Proinsulin C-peptide is the sequence of C peptide as it exists within proinsulin, the precursor to insulin which consists of insulin A chain, insulin B chain and C peptide (connecting peptide). In proinsulin, C peptide provides a means to ensure correct folding and assembly of the A and B chains. It is eventually cleaved away by proteases PC2, PC1/3 and CPE, at the flanking Arg-Arg and Lys-Arg
GLP-1 (1-37) (human),CAS#: 87805-34-3, Catalog Number: KS032002 GLP, synthesized by posttranslational processing of proglucagon in the intestine and pancreas, plays an important role in metabolic homeostasis. It is capable of converting intestinal epithelial cells into insulin-producing cells, thus serving as a new putative therapeutic compound for the treatment of diabetes mellitus. Technical Data M.Wt: 4169.52 Formula: C186H275N51O59 Sequence: HDEFERHAEGTFTSDVSSYLEGQAAKEFIA
IGF-I Analog,CAS#: 147819-32-7, Catalog Number: KS031011 IGF-I, insulin-like growth factor, also called as somatomedin 1, is a hormone peptide similar in structure to insulin. IGF-I is released in the presence of growth hormone and mediates its enterotrophic effect. Catalog Number KS031011 Category Peptides CAS Number 147819-32-7 MW 1249.52 Formula C55H88N14O15S2 Form/Appearance Lyophilized powder Purity > 95% Note For research use only. Storage Store at -20C or -80C
Exendin-4 (9-39) CAS 133514-43-9 Catalog Number KS031013 This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4. Technical Data for Exendin-3 (9-39) amideM. Wt3369.79FormulaC149H234N40O47SSequence(Modifications: Ser-31 = C
