KS-V Peptide is committed to innovative technology development and exploring new techniques for peptide synthesis. We have provided over 30,000 high-quality peptides to more than 3,000 scientists globally. Using our independently developed advanced microwave technology for peptide synthesis, KS-V Peptide can deliver peptides in as short as 3 days. Our strict QC testing service ensures that every peptide is delivered at a high level of quality.
Fast and high-quality delivery, if necessary, we will keep your synthetic peptide sequence strictly confidential and sign a confidentiality agreement with you.
Length | Up to 300 amino acids |
Purity | 80%,90%,95%,98%,99% |
Scale | ug、mg、g、kg |
Package | According to customer requirements (free subpackage within 10 tubes of each peptide) |
Modification | Provide 300+ different peptide modifications |
Test report | HPLC, LC/MS, COA reports (Provide the following test reports if needed: peptide content, water content, acetic acid content, trifluoroacetic acid content, endotoxin) |
Type | Sequence |
Long chain peptide | GLTYTMCDKTKFTWKRIPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIETNGGGFIEMQLPPGDNIIY VGELSHQWFQKGSSl-ys (biotin) |
Membrane Proteins | ALENLVVLNSASVAGAHGIISFLVFFCAAWYIKGRLVPGATYALYGVWPLLLLLLAPPRAVA |
Hydrophobic polypeptide |
|
Disulfide-Rich Peptides |
|
Modified Peptides |
|
KS-V Peptide is committed to innovative technology development and exploring new techniques for peptide synthesis. We have provided over 30,000 high-quality peptides to more than 3,000 scientists globally. Using our independently developed advanced microwave technology for peptide synthesis, KS-V Peptide can deliver peptides in as short as 3 days. Our strict QC testing service ensures that every peptide is delivered at a high level of quality.
Fast and high-quality delivery, if necessary, we will keep your synthetic peptide sequence strictly confidential and sign a confidentiality agreement with you.