• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Custom Peptide Services

    Peptide Synthesis Platform

     

     

    KS-V Peptide is committed to innovative technology development and exploring new techniques for peptide synthesis. We have provided over 30,000 high-quality peptides to more than 3,000 scientists globally. Using our independently developed advanced microwave technology for peptide synthesis, KS-V Peptide can deliver peptides in as short as 3 days. Our strict QC testing service ensures that every peptide is delivered at a high level of quality.

     

    Our Technical Advantages

     

     

    • Long chain peptide chemical total synthesis platform with up to 400 amino acids, and hydrophobic peptide chemical total synthesis platform with more than 130 amino acids
    • More than 300 kinds of cyclization and modification technologies, difficult peptide cyclization
    • Provide various complex peptide intermediate compounds, including non natural amino acid modified products
    • Provide comprehensive ADC/PDC/RDC linker compounds and internationally leading coupling chemistry technology
    • Overcoming compatibility issues between peptide solid-phase synthesis and DNA solid-phase synthesis, achieving efficient and one-time solid-phase synthesis of peptide and DNA chain coupling products
    • Provide coupling of peptides and liposomes to achieve targeted LNP
    • High-efficiency chemical total synthesis technology has overcome the glycopeptide synthesis problem that has plagued the scientific and industrial circles for more than ten years
    • International leading membrane protein expression and purification technology platform
    • The fastest delivery speed in the industry, as short as 3 days

     

    Ordinary peptide customized systhesis

     

    Fast and high-quality delivery, if necessary, we will keep your synthetic peptide sequence strictly confidential and sign a confidentiality agreement with you.

     

     

    Length Up to 300 amino acids
    Purity 80%,90%,95%,98%,99%
    Scale ug、mg、g、kg
    Package According to customer requirements (free subpackage within 10 tubes of each peptide)
    Modification Provide 300+ different peptide modifications
    Test report HPLC, LC/MS, COA reports (Provide the following test reports if needed: peptide content, water content, acetic acid content, trifluoroacetic acid content, endotoxin)

     

    Difficult peptide customized systhesis

     

    Type Sequence
    Long chain peptide GLTYTMCDKTKFTWKRIPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIETNGGGFIEMQLPPGDNIIY VGELSHQWFQKGSSl-ys (biotin)
    Membrane Proteins ALENLVVLNSASVAGAHGIISFLVFFCAAWYIKGRLVPGATYALYGVWPLLLLLLAPPRAVA
    Hydrophobic polypeptide
    • Azide-GLFIMIVGGLVGLRIV FAVLSIVN
    • And also synthesized B-amyloid protein (a hydrophobin that may cause Alzheimer's disease
    Disulfide-Rich Peptides
    • AVINDECPNVIGNRDIFKKVDWICEDCANIFRIDGLATLCRKNCFRNIDFLWCVYASERQAEKDELTRYVSILRAGSV (C1-C5.C2-C4.C3-C6)
    • KEGYPMGRDGCKISCVINNNFCKVECQAKWRQSDGYCYFWGLSCYCTNLPEDAQVWDSSTNKCG (C1-C8,C2-C5,C3-C6,and C4-C7)
    Modified Peptides
    • ARTK(me3)Q TARKSTGGK-K-FAM/li>
    • And 5000 molecular weight mPEG modifed peptides at the end of the aldehyde group

     

     

     

     

    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Custom Peptide Services

    Peptide Synthesis Platform

     

     

    KS-V Peptide is committed to innovative technology development and exploring new techniques for peptide synthesis. We have provided over 30,000 high-quality peptides to more than 3,000 scientists globally. Using our independently developed advanced microwave technology for peptide synthesis, KS-V Peptide can deliver peptides in as short as 3 days. Our strict QC testing service ensures that every peptide is delivered at a high level of quality.

     

    Our Technical Advantages

     

     

    • Long chain peptide chemical total synthesis platform with up to 400 amino acids, and hydrophobic peptide chemical total synthesis platform with more than 130 amino acids
    • More than 300 kinds of cyclization and modification technologies, difficult peptide cyclization
    • Provide various complex peptide intermediate compounds, including non natural amino acid modified products
    • Provide comprehensive ADC/PDC/RDC linker compounds and internationally leading coupling chemistry technology
    • Overcoming compatibility issues between peptide solid-phase synthesis and DNA solid-phase synthesis, achieving efficient and one-time solid-phase synthesis of peptide and DNA chain coupling products
    • Provide coupling of peptides and liposomes to achieve targeted LNP
    • High-efficiency chemical total synthesis technology has overcome the glycopeptide synthesis problem that has plagued the scientific and industrial circles for more than ten years
    • International leading membrane protein expression and purification technology platform
    • The fastest delivery speed in the industry, as short as 3 days

     

    Ordinary peptide customized systhesis

    Fast and high-quality delivery, if necessary, we will keep your synthetic peptide sequence strictly confidential and sign a confidentiality agreement with you.

     

     

     

     

    Difficult peptide customized systhesis