• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS021008 HIV-1 TAT Protein (47-57) YGRKKRRQRRR-OH (trifluoroacetate Salt) 191936-91-1 ≥95% (HPLC) $66
    KS021002 LL-37 YPYDVPDYA-OH (trifluoroacetate Salt) 154947-66-7 ≥95% (HPLC) $304
    KS021009 CRAMP (mouse) GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt) 376364-36-2 ≥95% (HPLC) $200
    KS021010 β-Defensin-2 (human) GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt) 372146-20-8 ≥95% (HPLC) $1333
    KS021012 Histatin 5 DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt) 104339-66-4 ≥95% (HPLC) $146
    KS021013 HIV (gp41) Fragment AVGIGA-OH (trifluoroacetate Salt) 129426-47-7 ≥95% (HPLC) $36
    KS021015 Cecropin B DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) 80451-05-4 ≥95% (HPLC) $288
    KS061035 Beta-MSH(Monkey) DEGPYRMEHFRWGSPPKD-OH (trifluoroacetate Salt) 17750-75-3 ≥95% (HPLC) $211
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS091012 Urotensin II (goby) AGTADCFWKYCV-OH (trifluoroacetate Salt) (Cys6 And 11 Bridge) 9047-55-6 ≥95% (HPLC) $146
    KS091002 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $370
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS091013 Urotensin II (human) ETPDCFWKYCV-OH (trifluoroacetate Salt) (Cys5 And 10 Bridge) 251293-28-4 ≥95% (HPLC) $67
    KS063038 Renin Substrate Tetradecapeptide (rat) DRVYIHPFHLLYYS-OH (trifluoroacetate Salt) 110200-37-8 ≥95% (HPLC) $231
    5 6 7 8 9 10 11 12
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS021008 HIV-1 TAT Protein (47-57) YGRKKRRQRRR-OH (trifluoroacetate Salt) 191936-91-1 ≥95% (HPLC) $66
    KS021002 LL-37 YPYDVPDYA-OH (trifluoroacetate Salt) 154947-66-7 ≥95% (HPLC) $304
    KS021009 CRAMP (mouse) GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt) 376364-36-2 ≥95% (HPLC) $200
    KS021010 β-Defensin-2 (human) GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt) 372146-20-8 ≥95% (HPLC) $1333
    KS021012 Histatin 5 DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt) 104339-66-4 ≥95% (HPLC) $146
    KS021013 HIV (gp41) Fragment AVGIGA-OH (trifluoroacetate Salt) 129426-47-7 ≥95% (HPLC) $36
    KS021015 Cecropin B DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) 80451-05-4 ≥95% (HPLC) $288
    KS061035 Beta-MSH(Monkey) DEGPYRMEHFRWGSPPKD-OH (trifluoroacetate Salt) 17750-75-3 ≥95% (HPLC) $211
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS091012 Urotensin II (goby) AGTADCFWKYCV-OH (trifluoroacetate Salt) (Cys6 And 11 Bridge) 9047-55-6 ≥95% (HPLC) $146
    KS091002 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $370
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS091013 Urotensin II (human) ETPDCFWKYCV-OH (trifluoroacetate Salt) (Cys5 And 10 Bridge) 251293-28-4 ≥95% (HPLC) $67
    KS063038 Renin Substrate Tetradecapeptide (rat) DRVYIHPFHLLYYS-OH (trifluoroacetate Salt) 110200-37-8 ≥95% (HPLC) $231
    5 6 7 8 9 10 11 12