• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS111004 Pannexin-1; Panx1 WRQAAFVDSY-OH (trifluoroacetate Salt) 955091-53-9 ≥95% (HPLC) $58
    KS111002 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 (trifluoroacetate Salt) 20449-79-0 ≥95% (HPLC) $214
    KS111003 5-Fam-Woodtide 5FAM-KKISGRLSPIMTEQ-NH2 (trifluoroacetate Salt) 1566528-51-5 ≥95% (HPLC) $143
    KS111001 Substrate For Tyrosine Protein Kinase RRLIEDNEYTARG-OH (trifluoroacetate Salt) 81493-98-3 ≥95% (HPLC) $77
    KS081002 Cyclo (-RADfE) Cyclo(RADfE) (ammonium Salt) 756500-23-9 ≥95% (HPLC) $91
    KS081007 Kisspeptin-10, Kiss1 (fish) YNLNSFGLRY-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $61
    KS081008 Kisspeptin-10, Kiss2 (fish, Frog) FNFNPFGLRF-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $61
    KS081001 MMP Inhibitor 1 Abz-GPDLaNH-OH (trifluoroacetate Salt) 124168-73-6 ≥95% (HPLC) $46
    KS081003 Integrin Binding Peptide Ac-GCGYGRGDSPG-NH2 (trifluoroacetate Salt) 278792-07-7 ≥95% (HPLC) $67
    KS082005 Fluorogenic MMP Substrate DNPPLGLWAr-NH2 (trifluoroacetate Salt) 121282-17-5 ≥95% (HPLC) $170
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS081004 MG-132 Z-LLL-CHO 133407-82-6 ≥95% (HPLC) $86
    KS081009 Calpain Substrate E(EDANS)PLFAERK(Dabcyl)-OH (trifluoroacetate Salt) 1914987-47-5 ≥95% (HPLC) $222
    KS141002 Biotin Labeled Steroid Receptor Coactivator-1 (SRC-1) Biotin-CPSSHSSLTERHKILHRLLQEGSPS-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $208
    KS141001 Fibronectin-Binding Protein FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV-OH (trifluoroacetate Salt) 119977-20-7 ≥95% (HPLC) $313
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% (HPLC) $64
    KS071007 GSK-3 Beta Peptide Inhibitor Myr-GKEAPPAPPQS(PO3H2)P-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $150
    KS071003 Caspase Inhibitor II Ac-AAVALLPAVLLALLAPVAD-CHO N/A ≥95% (HPLC) $277
    KS071004 Calcium Like Peptide 3 VKFGVGFK-OH (trifluoroacetate Salt) 261969-05-5 ≥95% (HPLC) $86
    1 2 3 4 5 6 7 8
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Peptides For Scientific Research

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS111004 Pannexin-1; Panx1 WRQAAFVDSY-OH (trifluoroacetate Salt) 955091-53-9 ≥95% (HPLC) $58
    KS111002 Melittin GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 (trifluoroacetate Salt) 20449-79-0 ≥95% (HPLC) $214
    KS111003 5-Fam-Woodtide 5FAM-KKISGRLSPIMTEQ-NH2 (trifluoroacetate Salt) 1566528-51-5 ≥95% (HPLC) $143
    KS111001 Substrate For Tyrosine Protein Kinase RRLIEDNEYTARG-OH (trifluoroacetate Salt) 81493-98-3 ≥95% (HPLC) $77
    KS081002 Cyclo (-RADfE) Cyclo(RADfE) (ammonium Salt) 756500-23-9 ≥95% (HPLC) $91
    KS081007 Kisspeptin-10, Kiss1 (fish) YNLNSFGLRY-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $61
    KS081008 Kisspeptin-10, Kiss2 (fish, Frog) FNFNPFGLRF-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $61
    KS081001 MMP Inhibitor 1 Abz-GPDLaNH-OH (trifluoroacetate Salt) 124168-73-6 ≥95% (HPLC) $46
    KS081003 Integrin Binding Peptide Ac-GCGYGRGDSPG-NH2 (trifluoroacetate Salt) 278792-07-7 ≥95% (HPLC) $67
    KS082005 Fluorogenic MMP Substrate DNPPLGLWAr-NH2 (trifluoroacetate Salt) 121282-17-5 ≥95% (HPLC) $170
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS081004 MG-132 Z-LLL-CHO 133407-82-6 ≥95% (HPLC) $86
    KS081009 Calpain Substrate E(EDANS)PLFAERK(Dabcyl)-OH (trifluoroacetate Salt) 1914987-47-5 ≥95% (HPLC) $222
    KS141002 Biotin Labeled Steroid Receptor Coactivator-1 (SRC-1) Biotin-CPSSHSSLTERHKILHRLLQEGSPS-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $208
    KS141001 Fibronectin-Binding Protein FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV-OH (trifluoroacetate Salt) 119977-20-7 ≥95% (HPLC) $313
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% (HPLC) $64
    KS071007 GSK-3 Beta Peptide Inhibitor Myr-GKEAPPAPPQS(PO3H2)P-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $150
    KS071003 Caspase Inhibitor II Ac-AAVALLPAVLLALLAPVAD-CHO N/A ≥95% (HPLC) $277
    KS071004 Calcium Like Peptide 3 VKFGVGFK-OH (trifluoroacetate Salt) 261969-05-5 ≥95% (HPLC) $86
    1 2 3 4 5 6 7 8