Peptides And Proteins

Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.

Home >

products >

Diabetes Peptides

CATALOGUE PRODUCT

Proteins

Histones

Membrane Proteins

Recombinant Proteins Expression Services

Ubiquitins

Ubiquitin

Ubiquitin Probes

Custom Peptide Services

Antigenic Peptides

Peptide Conjugations

Modified Peptides

Cyclic Peptides

Impurity Profiling

Catalog Peptides

Peptide Toxins

Peptide APIs

Peptides For Scientific Research

Diabetes Peptides

Alzheimer's Peptide

Multiple Sclerosis Peptides

Antimicrobial Peptides

Gastrointestinal Peptides

Hormone Peptide

Cardiovascular Peptides

COVID-19 Peptides

Hematology Peptides

Apoptosis Peptides

Inflammation Peptides

Cancer Peptides

Kinases Phosphatases Peptides

Miscellaneous Peptides

FRET Substrates Peptides

Immunomodulation Peptides

Enzyme Inhibitor Peptides

RGD Peptides

Neuropeptide Peptides

Peptide Analysis Services

HPLC

MS,LC-MS

MALDI-TOF

H/C/2D NMR

Elemental Analysis

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS033001	Glucagon (human)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt)	16941-32-5	≥95% (HPLC)	$239
KS031014	GLP-2 (rat)	HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH (trifluoroacetate Salt)	195262-56-7	≥95% (HPLC)	$272
KS031013	Exendin-4 (9-39)	DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (trifluoroacetate Salt)	133514-43-9	≥95% (HPLC)	$255
KS032009	GLP-2 (1-34) (human)	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt)	99120-49-7	≥95%	$280
KS032008	GLP-2 (1-33) (human)	HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt)	223460-79-5	≥95% (HPLC)	$272
KS032012	Amylin (rat)	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt)(Cys2 And 7 Bridge)	124447-81-0	≥95% (HPLC)	$457
KS032010	GLP-1 (1-36) Amide (human)	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (trifluoroacetate Salt)	99658-04-5	≥95% (HPLC)	$297
KS031003	Proinsulin C-Peptide (55-89) (human)	RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR	11097-48-6	≥95% (HPLC)	$288
KS031007	Oxyntomodulin (porcine, Bovine)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH (trifluoroacetate Salt)	74870-06-7	≥95%	$304
KS031004	Exendin-4; Exenatide	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	141758-74-9	≥95% (HPLC)	$321
KS031006	C-Peptide (human); Insulin Precursor (57-87) (human)	EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH (trifluoroacetate Salt)	33017-11-7	≥95% (HPLC)	$255
KS032005	Amylin (human)	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge)	122384-88-7	≥95%	$366
KS032002	GLP-1 (1-37) (human)	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt)	87805-34-3	≥95%	$304
KS031011	IGF-I Analog	CYAAPLKPAKSC-OH (trifluoroacetate Salt)	147819-32-7	≥95% (HPLC)	$146

Peptides And Proteins

Home >

products >

Diabetes Peptides

CATALOGUE PRODUCT

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS033001	Glucagon (human)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt)	16941-32-5	≥95% (HPLC)	$239
KS031014	GLP-2 (rat)	HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH (trifluoroacetate Salt)	195262-56-7	≥95% (HPLC)	$272
KS031013	Exendin-4 (9-39)	DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (trifluoroacetate Salt)	133514-43-9	≥95% (HPLC)	$255
KS032009	GLP-2 (1-34) (human)	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt)	99120-49-7	≥95%	$280
KS032008	GLP-2 (1-33) (human)	HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt)	223460-79-5	≥95% (HPLC)	$272
KS032012	Amylin (rat)	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt)(Cys2 And 7 Bridge)	124447-81-0	≥95% (HPLC)	$457
KS032010	GLP-1 (1-36) Amide (human)	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (trifluoroacetate Salt)	99658-04-5	≥95% (HPLC)	$297
KS031003	Proinsulin C-Peptide (55-89) (human)	RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR	11097-48-6	≥95% (HPLC)	$288
KS031007	Oxyntomodulin (porcine, Bovine)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH (trifluoroacetate Salt)	74870-06-7	≥95%	$304
KS031004	Exendin-4; Exenatide	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	141758-74-9	≥95% (HPLC)	$321
KS031006	C-Peptide (human); Insulin Precursor (57-87) (human)	EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH (trifluoroacetate Salt)	33017-11-7	≥95% (HPLC)	$255
KS032005	Amylin (human)	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge)	122384-88-7	≥95%	$366
KS032002	GLP-1 (1-37) (human)	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt)	87805-34-3	≥95%	$304
KS031011	IGF-I Analog	CYAAPLKPAKSC-OH (trifluoroacetate Salt)	147819-32-7	≥95% (HPLC)	$146

Call us

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

Address

#A2, National Health Big Data Industrial Park, Hefei, China

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

#A2, National Health Big Data Industrial Park, Hefei, China