• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Diabetes Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS033001 Glucagon (human) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt) 16941-32-5 ≥95% (HPLC) $239
    KS031014 GLP-2 (rat) HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH (trifluoroacetate Salt) 195262-56-7 ≥95% (HPLC) $272
    KS031013 Exendin-4 (9-39) DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (trifluoroacetate Salt) 133514-43-9 ≥95% (HPLC) $255
    KS032009 GLP-2 (1-34) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt) 99120-49-7 ≥95% $280
    KS032008 GLP-2 (1-33) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt) 223460-79-5 ≥95% (HPLC) $272
    KS032012 Amylin (rat) KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt)(Cys2 And 7 Bridge) 124447-81-0 ≥95% (HPLC) $457
    KS032010 GLP-1 (1-36) Amide (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (trifluoroacetate Salt) 99658-04-5 ≥95% (HPLC) $297
    KS031003 Proinsulin C-Peptide (55-89) (human) RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR 11097-48-6 ≥95% (HPLC) $288
    KS031007 Oxyntomodulin (porcine, Bovine) HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH (trifluoroacetate Salt) 74870-06-7 ≥95% $304
    KS031004 Exendin-4; Exenatide HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 141758-74-9 ≥95% (HPLC) $321
    KS031006 C-Peptide (human); Insulin Precursor (57-87) (human) EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH (trifluoroacetate Salt) 33017-11-7 ≥95% (HPLC) $255
    KS032005 Amylin (human) KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge) 122384-88-7 ≥95% $366
    KS032002 GLP-1 (1-37) (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt) 87805-34-3 ≥95% $304
    KS031011 IGF-I Analog CYAAPLKPAKSC-OH (trifluoroacetate Salt) 147819-32-7 ≥95% (HPLC) $146
    1
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Diabetes Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS033001 Glucagon (human) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt) 16941-32-5 ≥95% (HPLC) $239
    KS031014 GLP-2 (rat) HADGSFSDEMNTILDNLATRDFINWLIQTKITD-OH (trifluoroacetate Salt) 195262-56-7 ≥95% (HPLC) $272
    KS031013 Exendin-4 (9-39) DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (trifluoroacetate Salt) 133514-43-9 ≥95% (HPLC) $255
    KS032009 GLP-2 (1-34) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITDR-OH (trifluoroacetate Salt) 99120-49-7 ≥95% $280
    KS032008 GLP-2 (1-33) (human) HADGSFSDEMNTILDNLAARDFINWLIQTKITD-OH (trifluoroacetate Salt) 223460-79-5 ≥95% (HPLC) $272
    KS032012 Amylin (rat) KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt)(Cys2 And 7 Bridge) 124447-81-0 ≥95% (HPLC) $457
    KS032010 GLP-1 (1-36) Amide (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (trifluoroacetate Salt) 99658-04-5 ≥95% (HPLC) $297
    KS031003 Proinsulin C-Peptide (55-89) (human) RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR 11097-48-6 ≥95% (HPLC) $288
    KS031007 Oxyntomodulin (porcine, Bovine) HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA-OH (trifluoroacetate Salt) 74870-06-7 ≥95% $304
    KS031004 Exendin-4; Exenatide HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 141758-74-9 ≥95% (HPLC) $321
    KS031006 C-Peptide (human); Insulin Precursor (57-87) (human) EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH (trifluoroacetate Salt) 33017-11-7 ≥95% (HPLC) $255
    KS032005 Amylin (human) KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge) 122384-88-7 ≥95% $366
    KS032002 GLP-1 (1-37) (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt) 87805-34-3 ≥95% $304
    KS031011 IGF-I Analog CYAAPLKPAKSC-OH (trifluoroacetate Salt) 147819-32-7 ≥95% (HPLC) $146
    1