• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Antimicrobial Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS021014 β-Defensin-1 (human) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $889
    KS021011 Apelin (1-13) (human) QRPRLSHKGPMPF-OH (trifluoroacetate Salt) 217082-58-1 ≥95% (HPLC) $77
    KS022003 Fusion Inhibitory Peptide Z-fFG-OH 75539-79-6 ≥95% (HPLC) $40
    KS021007 HIV (GP120) Antigenic Peptide CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt) 198636-94-1 ≥95% (HPLC) $146
    KS021005 Leupeptin Ac-LLR-CHO (trifluoroacetate Salt) 103476-89-7 ≥95% (HPLC) $22
    KS021001 Influenza Hemagglutinin (HA) Peptide YPYDVPDYA-OH (trifluoroacetate Salt) 92000-76-5 ≥95% (HPLC) $55
    KS021006 Defensin HNP-3 (human) AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges) 136661-76-2 ≥95% (HPLC) $765
    KS022004 Malaria Aspartyl Proteinase FRET Substrate(Dabcyl-Edans Pair) DRVYIHPFHL-OH (trifluoroacetate Salt) 263718-22-5 ≥95% (HPLC) $255
    KS021008 HIV-1 TAT Protein (47-57) YGRKKRRQRRR-OH (trifluoroacetate Salt) 191936-91-1 ≥95% (HPLC) $66
    KS021002 LL-37 YPYDVPDYA-OH (trifluoroacetate Salt) 154947-66-7 ≥95% (HPLC) $304
    KS021009 CRAMP (mouse) GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt) 376364-36-2 ≥95% (HPLC) $200
    KS021010 β-Defensin-2 (human) GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt) 372146-20-8 ≥95% (HPLC) $1333
    KS021012 Histatin 5 DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt) 104339-66-4 ≥95% (HPLC) $146
    KS021013 HIV (gp41) Fragment AVGIGA-OH (trifluoroacetate Salt) 129426-47-7 ≥95% (HPLC) $36
    KS021015 Cecropin B DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) 80451-05-4 ≥95% (HPLC) $288
    1
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Antimicrobial Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS021014 β-Defensin-1 (human) DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $889
    KS021011 Apelin (1-13) (human) QRPRLSHKGPMPF-OH (trifluoroacetate Salt) 217082-58-1 ≥95% (HPLC) $77
    KS022003 Fusion Inhibitory Peptide Z-fFG-OH 75539-79-6 ≥95% (HPLC) $40
    KS021007 HIV (GP120) Antigenic Peptide CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt) 198636-94-1 ≥95% (HPLC) $146
    KS021005 Leupeptin Ac-LLR-CHO (trifluoroacetate Salt) 103476-89-7 ≥95% (HPLC) $22
    KS021001 Influenza Hemagglutinin (HA) Peptide YPYDVPDYA-OH (trifluoroacetate Salt) 92000-76-5 ≥95% (HPLC) $55
    KS021006 Defensin HNP-3 (human) AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges) 136661-76-2 ≥95% (HPLC) $765
    KS022004 Malaria Aspartyl Proteinase FRET Substrate(Dabcyl-Edans Pair) DRVYIHPFHL-OH (trifluoroacetate Salt) 263718-22-5 ≥95% (HPLC) $255
    KS021008 HIV-1 TAT Protein (47-57) YGRKKRRQRRR-OH (trifluoroacetate Salt) 191936-91-1 ≥95% (HPLC) $66
    KS021002 LL-37 YPYDVPDYA-OH (trifluoroacetate Salt) 154947-66-7 ≥95% (HPLC) $304
    KS021009 CRAMP (mouse) GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt) 376364-36-2 ≥95% (HPLC) $200
    KS021010 β-Defensin-2 (human) GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt) 372146-20-8 ≥95% (HPLC) $1333
    KS021012 Histatin 5 DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt) 104339-66-4 ≥95% (HPLC) $146
    KS021013 HIV (gp41) Fragment AVGIGA-OH (trifluoroacetate Salt) 129426-47-7 ≥95% (HPLC) $36
    KS021015 Cecropin B DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt) 80451-05-4 ≥95% (HPLC) $288
    1