Peptides And Proteins

Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.

Home >

products >

Antimicrobial Peptides

CATALOGUE PRODUCT

Proteins

Histones

Membrane Proteins

Recombinant Proteins Expression Services

Ubiquitins

Ubiquitin

Ubiquitin Probes

Custom Peptide Services

Antigenic Peptides

Peptide Conjugations

Modified Peptides

Cyclic Peptides

Impurity Profiling

Catalog Peptides

Peptide Toxins

Peptide APIs

Peptides For Scientific Research

Diabetes Peptides

Alzheimer's Peptide

Multiple Sclerosis Peptides

Antimicrobial Peptides

Gastrointestinal Peptides

Hormone Peptide

Cardiovascular Peptides

COVID-19 Peptides

Hematology Peptides

Apoptosis Peptides

Inflammation Peptides

Cancer Peptides

Kinases Phosphatases Peptides

Miscellaneous Peptides

FRET Substrates Peptides

Immunomodulation Peptides

Enzyme Inhibitor Peptides

RGD Peptides

Neuropeptide Peptides

Peptide Analysis Services

HPLC

MS,LC-MS

MALDI-TOF

H/C/2D NMR

Elemental Analysis

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS021014	β-Defensin-1 (human)	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$889
KS021011	Apelin (1-13) (human)	QRPRLSHKGPMPF-OH (trifluoroacetate Salt)	217082-58-1	≥95% (HPLC)	$77
KS022003	Fusion Inhibitory Peptide	Z-fFG-OH	75539-79-6	≥95% (HPLC)	$40
KS021007	HIV (GP120) Antigenic Peptide	CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt)	198636-94-1	≥95% (HPLC)	$146
KS021005	Leupeptin	Ac-LLR-CHO (trifluoroacetate Salt)	103476-89-7	≥95% (HPLC)	$22
KS021001	Influenza Hemagglutinin (HA) Peptide	YPYDVPDYA-OH (trifluoroacetate Salt)	92000-76-5	≥95% (HPLC)	$55
KS021006	Defensin HNP-3 (human)	AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges)	136661-76-2	≥95% (HPLC)	$765
KS022004	Malaria Aspartyl Proteinase FRET Substrate（Dabcyl-Edans Pair）	DRVYIHPFHL-OH (trifluoroacetate Salt)	263718-22-5	≥95% (HPLC)	$255
KS021008	HIV-1 TAT Protein (47-57)	YGRKKRRQRRR-OH (trifluoroacetate Salt)	191936-91-1	≥95% (HPLC)	$66
KS021002	LL-37	YPYDVPDYA-OH (trifluoroacetate Salt)	154947-66-7	≥95% (HPLC)	$304
KS021009	CRAMP (mouse)	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt)	376364-36-2	≥95% (HPLC)	$200
KS021010	β-Defensin-2 (human)	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt)	372146-20-8	≥95% (HPLC)	$1333
KS021012	Histatin 5	DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt)	104339-66-4	≥95% (HPLC)	$146
KS021013	HIV (gp41) Fragment	AVGIGA-OH (trifluoroacetate Salt)	129426-47-7	≥95% (HPLC)	$36
KS021015	Cecropin B	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt)	80451-05-4	≥95% (HPLC)	$288

Peptides And Proteins

Home >

products >

Antimicrobial Peptides

CATALOGUE PRODUCT

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS021014	β-Defensin-1 (human)	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$889
KS021011	Apelin (1-13) (human)	QRPRLSHKGPMPF-OH (trifluoroacetate Salt)	217082-58-1	≥95% (HPLC)	$77
KS022003	Fusion Inhibitory Peptide	Z-fFG-OH	75539-79-6	≥95% (HPLC)	$40
KS021007	HIV (GP120) Antigenic Peptide	CGKIEPLGVAPTKAKRRVVQREKR-OH (trifluoroacetate Salt)	198636-94-1	≥95% (HPLC)	$146
KS021005	Leupeptin	Ac-LLR-CHO (trifluoroacetate Salt)	103476-89-7	≥95% (HPLC)	$22
KS021001	Influenza Hemagglutinin (HA) Peptide	YPYDVPDYA-OH (trifluoroacetate Salt)	92000-76-5	≥95% (HPLC)	$55
KS021006	Defensin HNP-3 (human)	AFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL-OH (trifluoroacetate Salt) (Cys4 And Cys31/Cys6 And Cys20/Cys10 And Cys30 Disulfide Bridges)	136661-76-2	≥95% (HPLC)	$765
KS022004	Malaria Aspartyl Proteinase FRET Substrate（Dabcyl-Edans Pair）	DRVYIHPFHL-OH (trifluoroacetate Salt)	263718-22-5	≥95% (HPLC)	$255
KS021008	HIV-1 TAT Protein (47-57)	YGRKKRRQRRR-OH (trifluoroacetate Salt)	191936-91-1	≥95% (HPLC)	$66
KS021002	LL-37	YPYDVPDYA-OH (trifluoroacetate Salt)	154947-66-7	≥95% (HPLC)	$304
KS021009	CRAMP (mouse)	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH (trifluoroacetate Salt)	376364-36-2	≥95% (HPLC)	$200
KS021010	β-Defensin-2 (human)	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP-OH (trifluoroacetate Salt)	372146-20-8	≥95% (HPLC)	$1333
KS021012	Histatin 5	DSHAKRHHGYKRKFHEKHHSHRGY-OH (trifluoroacetate Salt)	104339-66-4	≥95% (HPLC)	$146
KS021013	HIV (gp41) Fragment	AVGIGA-OH (trifluoroacetate Salt)	129426-47-7	≥95% (HPLC)	$36
KS021015	Cecropin B	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK-OH (trifluoroacetate Salt)	80451-05-4	≥95% (HPLC)	$288

Call us

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

Address

#A2, National Health Big Data Industrial Park, Hefei, China

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

#A2, National Health Big Data Industrial Park, Hefei, China