Products
Peptides And Proteins
Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
Home >

products >

Gastrointestinal Peptides

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
Catalog Number Product Name Sequence CAS NO Purity Price/1mg
KS042013 Insulin B (13 – 23) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $87
KS042001 Somatostatin 14 AGCKNFFWKTFTSC-OH (Disulfide Bridge) 38916-34-6 ≥95% (HPLC) $164
KS042004 Peptide YY (canine, Mouse, Porcine, Rat) YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 (trifluoroacetate Salt) 81858-94-8 ≥95% (HPLC) $297
KS042006 Gastrin 1 (human) Glp-GPWLEEEEEAYGWMDF-NH2 10047-33-3 ≥95% (HPLC) $100
KS042002 Octreotide FCFwKTCT-ol (Disulfide Bridge) 79517-01-4 ≥95% (HPLC) $164
KS041016 PHI-27 (rat) HADGVFTSDYSRLLGQISAKKYLESLI-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $222
KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
KS041003 GIP (human) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH 100040-31-1 ≥95% (HPLC) $444
KS042007 Caerulein Glp-GPWLEEEEEAYGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
KS042010 VIP Receptor Antagonist (Human, Bovine, Porcine, Rat) HSDAVf(4-Cl)TDNYTRLRKQLAVKKYLNSILNNH2 (trifluoroacetate Salt) 102805-45-8 ≥95% (HPLC) $231
KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
KS041015 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 96849-38-6 ≥95% (HPLC) $304
KS041017 Uroguanylin (human) NDDCELCVNVACTGCL 152175-68-3 ≥95% (HPLC) $95
1
Products
Peptides And Proteins
Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
Home >

products >

Gastrointestinal Peptides

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
Catalog Number Product Name Sequence CAS NO Purity Price/1mg
KS042013 Insulin B (13 – 23) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $87
KS042001 Somatostatin 14 AGCKNFFWKTFTSC-OH (Disulfide Bridge) 38916-34-6 ≥95% (HPLC) $164
KS042004 Peptide YY (canine, Mouse, Porcine, Rat) YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 (trifluoroacetate Salt) 81858-94-8 ≥95% (HPLC) $297
KS042006 Gastrin 1 (human) Glp-GPWLEEEEEAYGWMDF-NH2 10047-33-3 ≥95% (HPLC) $100
KS042002 Octreotide FCFwKTCT-ol (Disulfide Bridge) 79517-01-4 ≥95% (HPLC) $164
KS041016 PHI-27 (rat) HADGVFTSDYSRLLGQISAKKYLESLI-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $222
KS042005 Peptide YY (human) YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRTY-NH2 (trifluoroacetate Salt) 118997-30-1 ≥95% (HPLC) $297
KS041003 GIP (human) YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH 100040-31-1 ≥95% (HPLC) $444
KS042007 Caerulein Glp-GPWLEEEEEAYGWMDF-NH2 17650-98-5 ≥95% (HPLC) $71
KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
KS042010 VIP Receptor Antagonist (Human, Bovine, Porcine, Rat) HSDAVf(4-Cl)TDNYTRLRKQLAVKKYLNSILNNH2 (trifluoroacetate Salt) 102805-45-8 ≥95% (HPLC) $231
KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
KS041015 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 96849-38-6 ≥95% (HPLC) $304
KS041017 Uroguanylin (human) NDDCELCVNVACTGCL 152175-68-3 ≥95% (HPLC) $95
1