Peptides And Proteins

Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.

Home >

products >

Hormone Peptide

CATALOGUE PRODUCT

Proteins

Histones

Membrane Proteins

Recombinant Proteins Expression Services

Ubiquitins

Ubiquitin

Ubiquitin Probes

Custom Peptide Services

Antigenic Peptides

Peptide Conjugations

Modified Peptides

Cyclic Peptides

Impurity Profiling

Catalog Peptides

Peptide Toxins

Peptide APIs

Peptides For Scientific Research

Diabetes Peptides

Alzheimer's Peptide

Multiple Sclerosis Peptides

Antimicrobial Peptides

Gastrointestinal Peptides

Hormone Peptide

Cardiovascular Peptides

COVID-19 Peptides

Hematology Peptides

Apoptosis Peptides

Inflammation Peptides

Cancer Peptides

Kinases Phosphatases Peptides

Miscellaneous Peptides

FRET Substrates Peptides

Immunomodulation Peptides

Enzyme Inhibitor Peptides

RGD Peptides

Neuropeptide Peptides

Peptide Analysis Services

HPLC

MS,LC-MS

MALDI-TOF

H/C/2D NMR

Elemental Analysis

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS063002	Angiotensin II (human)	DRVYIHPF-OH (trifluoroacetate Salt)	4474-91-3	≥95% (HPLC)	$49
KS062001	Angiotensin Converting Enzyme Inhibitor	Glp-WPRPQIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$55
KS062008	Angiotensin I Converting Enzyme Inhibitor 3	RPGFSPFR-OH (trifluoroacetate Salt)	258279-04-8	≥95% (HPLC)	$49
KS042013	Insulin B (13 – 23)	EALYLVCGERG	N/A	≥95% (HPLC)	$87
KS061041	Pancreatic Polypeptide (rat)	APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt)	90419-12-8	≥95% (HPLC)	$164
KS061034	Cosyntropin	SYSMEHFRWGKPVGKKRRPVKVYP-OH	16960-16-0	≥95% (HPLC)	$146
KS062025	Calcitonin Gene Related Peptide (rat)	SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	96827-03-1	≥95% (HPLC)	$408
KS032012	Amylin (rat)	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	124447-81-0	≥95% (HPLC)	$457
KS062003	Teriparatide Acetate	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH	52232-67-4	≥95% (HPLC)	$280
KS033001	Glucagon (human)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt)	16941-32-5	≥95% (HPLC)	$239
KS061009	Calcitonin (human)	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH	21215-62-3	≥95% (HPLC)	$395
KS032005	Amylin (human)	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge)	122384-88-7	≥95% (HPLC)	$366
KS062021	Angiotensin III (human)	RVYIHPF-OH (trifluoroacetate Salt)	100900-06-9	≥95% (HPLC)	$48
KS061016	Aviptadil	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2	40077-57-4	≥95% (HPLC)	$231
KS063011	Substance P	RPKPQQFFGLM-NH2 (trifluoroacetate Salt)	33507-63-0	≥95% (HPLC)	$64
KS062006	Angiotensin I Converting Enzyme Inhibitor 1	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	30892-86-5	≥95% (HPLC)	$67
KS061015	Melanin Concentrating Hormone (human)	DFDMLRCMLGRVYRPCWQV-OH (trifluoroacetate Salt) (Disulfide Bond)	128315-56-0	≥95% (HPLC)	$335
KS062014	Calcitonin Gene Related Peptide II (human)	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)	98824-26-1	≥95% (HPLC)	$457
KS062013	Calcitonin Gene Related Peptide (human)	ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2	90954-53-3	≥95% (HPLC)	$457
KS042002	Octreotide	FCFwKTCT-ol (Disulfide Bridge)	79517-01-4	≥95% (HPLC)	$164

1 2 3

Peptides And Proteins

Home >

products >

Hormone Peptide

CATALOGUE PRODUCT

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS063002	Angiotensin II (human)	DRVYIHPF-OH (trifluoroacetate Salt)	4474-91-3	≥95% (HPLC)	$49
KS062001	Angiotensin Converting Enzyme Inhibitor	Glp-WPRPQIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$55
KS062008	Angiotensin I Converting Enzyme Inhibitor 3	RPGFSPFR-OH (trifluoroacetate Salt)	258279-04-8	≥95% (HPLC)	$49
KS042013	Insulin B (13 – 23)	EALYLVCGERG	N/A	≥95% (HPLC)	$87
KS061041	Pancreatic Polypeptide (rat)	APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt)	90419-12-8	≥95% (HPLC)	$164
KS061034	Cosyntropin	SYSMEHFRWGKPVGKKRRPVKVYP-OH	16960-16-0	≥95% (HPLC)	$146
KS062025	Calcitonin Gene Related Peptide (rat)	SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	96827-03-1	≥95% (HPLC)	$408
KS032012	Amylin (rat)	KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	124447-81-0	≥95% (HPLC)	$457
KS062003	Teriparatide Acetate	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH	52232-67-4	≥95% (HPLC)	$280
KS033001	Glucagon (human)	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt)	16941-32-5	≥95% (HPLC)	$239
KS061009	Calcitonin (human)	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH	21215-62-3	≥95% (HPLC)	$395
KS032005	Amylin (human)	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge)	122384-88-7	≥95% (HPLC)	$366
KS062021	Angiotensin III (human)	RVYIHPF-OH (trifluoroacetate Salt)	100900-06-9	≥95% (HPLC)	$48
KS061016	Aviptadil	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2	40077-57-4	≥95% (HPLC)	$231
KS063011	Substance P	RPKPQQFFGLM-NH2 (trifluoroacetate Salt)	33507-63-0	≥95% (HPLC)	$64
KS062006	Angiotensin I Converting Enzyme Inhibitor 1	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	30892-86-5	≥95% (HPLC)	$67
KS061015	Melanin Concentrating Hormone (human)	DFDMLRCMLGRVYRPCWQV-OH (trifluoroacetate Salt) (Disulfide Bond)	128315-56-0	≥95% (HPLC)	$335
KS062014	Calcitonin Gene Related Peptide II (human)	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)	98824-26-1	≥95% (HPLC)	$457
KS062013	Calcitonin Gene Related Peptide (human)	ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2	90954-53-3	≥95% (HPLC)	$457
KS042002	Octreotide	FCFwKTCT-ol (Disulfide Bridge)	79517-01-4	≥95% (HPLC)	$164

1 2 3

Call us

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

Address

#A2, National Health Big Data Industrial Park, Hefei, China

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

#A2, National Health Big Data Industrial Park, Hefei, China