• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS062001 Angiotensin Converting Enzyme Inhibitor Glp-WPRPQIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $55
    KS062008 Angiotensin I Converting Enzyme Inhibitor 3 RPGFSPFR-OH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $49
    KS042013 Insulin B (13 – 23) EALYLVCGERG N/A ≥95% (HPLC) $87
    KS061041 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $164
    KS061034 Cosyntropin SYSMEHFRWGKPVGKKRRPVKVYP-OH 16960-16-0 ≥95% (HPLC) $146
    KS062025 Calcitonin Gene Related Peptide (rat) SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 96827-03-1 ≥95% (HPLC) $408
    KS032012 Amylin (rat) KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 124447-81-0 ≥95% (HPLC) $457
    KS062003 Teriparatide Acetate SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH 52232-67-4 ≥95% (HPLC) $280
    KS033001 Glucagon (human) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt) 16941-32-5 ≥95% (HPLC) $239
    KS061009 Calcitonin (human) SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 21215-62-3 ≥95% (HPLC) $395
    KS032005 Amylin (human) KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge) 122384-88-7 ≥95% (HPLC) $366
    KS062021 Angiotensin III (human) RVYIHPF-OH (trifluoroacetate Salt) 100900-06-9 ≥95% (HPLC) $48
    KS061016 Aviptadil HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 40077-57-4 ≥95% (HPLC) $231
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% (HPLC) $64
    KS062006 Angiotensin I Converting Enzyme Inhibitor 1 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 30892-86-5 ≥95% (HPLC) $67
    KS061015 Melanin Concentrating Hormone (human) DFDMLRCMLGRVYRPCWQV-OH (trifluoroacetate Salt) (Disulfide Bond) 128315-56-0 ≥95% (HPLC) $335
    KS062014 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $457
    KS062013 Calcitonin Gene Related Peptide (human) ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 90954-53-3 ≥95% (HPLC) $457
    KS042002 Octreotide FCFwKTCT-ol (Disulfide Bridge) 79517-01-4 ≥95% (HPLC) $164
    1 2 3
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS062001 Angiotensin Converting Enzyme Inhibitor Glp-WPRPQIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $55
    KS062008 Angiotensin I Converting Enzyme Inhibitor 3 RPGFSPFR-OH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $49
    KS042013 Insulin B (13 – 23) EALYLVCGERG N/A ≥95% (HPLC) $87
    KS061041 Pancreatic Polypeptide (rat) APLEPMYPGDYATHEQRAQYETQLRRYINTLTRPRY-NH2 (trifluoroacetate Salt) 90419-12-8 ≥95% (HPLC) $164
    KS061034 Cosyntropin SYSMEHFRWGKPVGKKRRPVKVYP-OH 16960-16-0 ≥95% (HPLC) $146
    KS062025 Calcitonin Gene Related Peptide (rat) SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 96827-03-1 ≥95% (HPLC) $408
    KS032012 Amylin (rat) KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 124447-81-0 ≥95% (HPLC) $457
    KS062003 Teriparatide Acetate SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH 52232-67-4 ≥95% (HPLC) $280
    KS033001 Glucagon (human) HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH (trifluoroacetate Salt) 16941-32-5 ≥95% (HPLC) $239
    KS061009 Calcitonin (human) SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 21215-62-3 ≥95% (HPLC) $395
    KS032005 Amylin (human) KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OH (trifluoroacetate Salt) (Cys2 And 7 Bridge) 122384-88-7 ≥95% (HPLC) $366
    KS062021 Angiotensin III (human) RVYIHPF-OH (trifluoroacetate Salt) 100900-06-9 ≥95% (HPLC) $48
    KS061016 Aviptadil HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 40077-57-4 ≥95% (HPLC) $231
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% (HPLC) $64
    KS062006 Angiotensin I Converting Enzyme Inhibitor 1 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 30892-86-5 ≥95% (HPLC) $67
    KS061015 Melanin Concentrating Hormone (human) DFDMLRCMLGRVYRPCWQV-OH (trifluoroacetate Salt) (Disulfide Bond) 128315-56-0 ≥95% (HPLC) $335
    KS062014 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $457
    KS062013 Calcitonin Gene Related Peptide (human) ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 90954-53-3 ≥95% (HPLC) $457
    KS042002 Octreotide FCFwKTCT-ol (Disulfide Bridge) 79517-01-4 ≥95% (HPLC) $164
    1 2 3