• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS061026 Egg Laying Hormone ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK-NH2 (trifluoroacetate Salt) 117680-39-4 ≥95% (HPLC) $297
    KS061032 ACTH (1-13) (human) SYSMEHFRWGKPV-OH (trifluoroacetate Salt) 22006-64-0 ≥95% (HPLC) $91
    KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
    KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
    KS061033 ACTH (1-39) (rat) SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH (trifluoroacetate Salt) 77465-10-2 ≥95% (HPLC) $321
    KS061031 GTP-Binding Protein Fragment CKQLQKDKQVYRATHR-OH (trifluoroacetate Salt) 101038-78-2 ≥95% (HPLC) $97
    KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
    KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
    KS061034 Cosyntropin SYSMEHFRWGKPVGKKRRPVKVYP-OH 16960-16-0 ≥95% (HPLC) $146
    KS061036 Alpha-Mating Factor Pheromone WHWLQLKPGQPMY-OH (trifluoroacetate Salt) 59401-28-4 ≥95% (HPLC) $77
    KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
    KS061037 Allatostatin I APSGAQRLYGFGL-NH2 (trifluoroacetate Salt) 123338-10-3 ≥95% (HPLC) $77
    KS032002 GLP-1 (1-37) (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt) 87805-34-3 ≥95% (HPLC) $304
    KS061039 Calcitonin (salmon) CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 47931-85-1 ≥95% (HPLC) $219
    KS063038 Renin Substrate Tetradecapeptide (rat) DRVYIHPFHLLYYS-OH (trifluoroacetate Salt) 110200-37-8 ≥95% (HPLC) $231
    KS061007 Ghrelin (human) GSS(palmitoyl)FLSPEHQKAQQRKESKKPPAKLQPROH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $286
    KS061010 ACTH (1-39), Human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 12279-41-3 ≥95% (HPLC) $321
    KS061040 Neurokinin A (Porcine) HKTDSFVGLM-NH2 (trifluoroacetate Salt) 86933-74-6 ≥95% (HPLC) $59
    KS061035 Beta-MSH(Monkey) DEGPYRMEHFRWGSPPKD-OH (trifluoroacetate Salt) 17750-75-3 ≥95% (HPLC) $211
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    1 2 3
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Hormone Peptide

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS061026 Egg Laying Hormone ISINQDLKAITDMLLTEQIRERQRYLADLRQRLLEK-NH2 (trifluoroacetate Salt) 117680-39-4 ≥95% (HPLC) $297
    KS061032 ACTH (1-13) (human) SYSMEHFRWGKPV-OH (trifluoroacetate Salt) 22006-64-0 ≥95% (HPLC) $91
    KS042009 Gastrin-Releasing Peptide (human) VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 (trifluoroacetate Salt) 93755-85-2 ≥95% (HPLC) $222
    KS042008 Secretin (porcine) HSDGTFTSELSRLRDSARLQRLLQGLV-NH2 (acetate Salt) 17034-34-3 ≥95% (HPLC) $222
    KS061033 ACTH (1-39) (rat) SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH (trifluoroacetate Salt) 77465-10-2 ≥95% (HPLC) $321
    KS061031 GTP-Binding Protein Fragment CKQLQKDKQVYRATHR-OH (trifluoroacetate Salt) 101038-78-2 ≥95% (HPLC) $97
    KS042012 Secretin (human) HSDGTFTSELSRLREGARLQRLLQGLV-NH2 (trifluoroacetate Salt) 108153-74-8 ≥95% (HPLC) $222
    KS042011 DOTA-[Tyr3]-Octreotide DOTA-fCYwKTCT-ol (trifluoroacetate Salt) (Cys2 And 7 Bridge) 177943-89-4 ≥95% (HPLC) $528
    KS061034 Cosyntropin SYSMEHFRWGKPVGKKRRPVKVYP-OH 16960-16-0 ≥95% (HPLC) $146
    KS061036 Alpha-Mating Factor Pheromone WHWLQLKPGQPMY-OH (trifluoroacetate Salt) 59401-28-4 ≥95% (HPLC) $77
    KS042014 Motilin (human, Porcine) FVPIFTYGELQRMQEKERNKGQ-OH (trifluoroacetate Salt) 9072-41-7 ≥95% (HPLC) $129
    KS061037 Allatostatin I APSGAQRLYGFGL-NH2 (trifluoroacetate Salt) 123338-10-3 ≥95% (HPLC) $77
    KS032002 GLP-1 (1-37) (human) HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH (trifluoroacetate Salt) 87805-34-3 ≥95% (HPLC) $304
    KS061039 Calcitonin (salmon) CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 47931-85-1 ≥95% (HPLC) $219
    KS063038 Renin Substrate Tetradecapeptide (rat) DRVYIHPFHLLYYS-OH (trifluoroacetate Salt) 110200-37-8 ≥95% (HPLC) $231
    KS061007 Ghrelin (human) GSS(palmitoyl)FLSPEHQKAQQRKESKKPPAKLQPROH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $286
    KS061010 ACTH (1-39), Human SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OH 12279-41-3 ≥95% (HPLC) $321
    KS061040 Neurokinin A (Porcine) HKTDSFVGLM-NH2 (trifluoroacetate Salt) 86933-74-6 ≥95% (HPLC) $59
    KS061035 Beta-MSH(Monkey) DEGPYRMEHFRWGSPPKD-OH (trifluoroacetate Salt) 17750-75-3 ≥95% (HPLC) $211
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    1 2 3