• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Cardiovascular Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS091010 Renin Inhibitor III RRPFHStaIHK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $79
    KS091008 Intermedin (human) TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15) 1188922-20-4 ≥95% (HPLC) $749
    KS091003 Bradykinin RPPGFSPFR-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $55
    KS062013 Calcitonin Gene Related Peptide (human) ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 90954-53-3 ≥95% (HPLC) $457
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS091009 Intermedin (rat) PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15) 1816940-00-7 ≥95% (HPLC) $749
    KS062025 Calcitonin Gene Related Peptide (rat) SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 96827-03-1 ≥95% (HPLC) $408
    KS062001 Angiotensin Converting Enzyme Inhibitor Glp-WPRPQIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $55
    KS062008 Angiotensin I Converting Enzyme Inhibitor 3 RPGFSPFR-OH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $67
    KS062014 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $457
    KS062021 Angiotensin III (human) RVYIHPF-OH (trifluoroacetate Salt) 100900-06-9 ≥95% (HPLC) $48
    KS091006 Adrenomedullin (1-52) (porcine) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge) 912862-96-5 ≥95% (HPLC) $1146
    KS091001 Angiotensin I Converting Enzyme Inhibitor 2 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $67
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS092004 Angiotensin I (human) DRVYIHPFHL-OH (trifluoroacetate Salt) 70937-97-2 ≥95% (HPLC) $58
    KS062006 Angiotensin I Converting Enzyme Inhibitor 1 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 30892-86-5 ≥95% (HPLC) $67
    KS091005 Adrenomedullin (1-52) (human) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge) 148498-78-6 ≥95% (HPLC) $765
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS091007 Copeptin (human) ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH (trifluoroacetate Salt) 78362-34-2 ≥95% (HPLC) $321
    KS091011 Hoe 140 RRP-Hyp-G-thi-S-Dtic-Oic-R-OH 130308-48-4 ≥95% (HPLC) $133
    1 2
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Cardiovascular Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS091010 Renin Inhibitor III RRPFHStaIHK-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $79
    KS091008 Intermedin (human) TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15) 1188922-20-4 ≥95% (HPLC) $749
    KS091003 Bradykinin RPPGFSPFR-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $55
    KS062013 Calcitonin Gene Related Peptide (human) ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 90954-53-3 ≥95% (HPLC) $457
    KS063002 Angiotensin II (human) DRVYIHPF-OH (trifluoroacetate Salt) 4474-91-3 ≥95% (HPLC) $49
    KS091009 Intermedin (rat) PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15) 1816940-00-7 ≥95% (HPLC) $749
    KS062025 Calcitonin Gene Related Peptide (rat) SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge) 96827-03-1 ≥95% (HPLC) $408
    KS062001 Angiotensin Converting Enzyme Inhibitor Glp-WPRPQIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $55
    KS062008 Angiotensin I Converting Enzyme Inhibitor 3 RPGFSPFR-OH (trifluoroacetate Salt) 258279-04-8 ≥95% (HPLC) $67
    KS062014 Calcitonin Gene Related Peptide II (human) ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt) 98824-26-1 ≥95% (HPLC) $457
    KS062021 Angiotensin III (human) RVYIHPF-OH (trifluoroacetate Salt) 100900-06-9 ≥95% (HPLC) $48
    KS091006 Adrenomedullin (1-52) (porcine) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge) 912862-96-5 ≥95% (HPLC) $1146
    KS091001 Angiotensin I Converting Enzyme Inhibitor 2 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 35115-60-7 ≥95% (HPLC) $67
    KS062018 ANP (1-28); Carperitide SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge) 89213-87-6 ≥95% (HPLC) $346
    KS092004 Angiotensin I (human) DRVYIHPFHL-OH (trifluoroacetate Salt) 70937-97-2 ≥95% (HPLC) $58
    KS062006 Angiotensin I Converting Enzyme Inhibitor 1 Glp-GLPPGPPIPP-OH (trifluoroacetate Salt) 30892-86-5 ≥95% (HPLC) $67
    KS091005 Adrenomedullin (1-52) (human) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge) 148498-78-6 ≥95% (HPLC) $765
    KS084006 Angiotensin I/II (1-7) DRVYIHP-OH (trifluoroacetate Salt) 51833-78-4 ≥95% (HPLC) $42
    KS091007 Copeptin (human) ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH (trifluoroacetate Salt) 78362-34-2 ≥95% (HPLC) $321
    KS091011 Hoe 140 RRP-Hyp-G-thi-S-Dtic-Oic-R-OH 130308-48-4 ≥95% (HPLC) $133
    1 2