Peptides And Proteins

Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.

Home >

products >

Cardiovascular Peptides

CATALOGUE PRODUCT

Proteins

Histones

Membrane Proteins

Recombinant Proteins Expression Services

Ubiquitins

Ubiquitin

Ubiquitin Probes

Custom Peptide Services

Antigenic Peptides

Peptide Conjugations

Modified Peptides

Cyclic Peptides

Impurity Profiling

Catalog Peptides

Peptide Toxins

Peptide APIs

Peptides For Scientific Research

Diabetes Peptides

Alzheimer's Peptide

Multiple Sclerosis Peptides

Antimicrobial Peptides

Gastrointestinal Peptides

Hormone Peptide

Cardiovascular Peptides

COVID-19 Peptides

Hematology Peptides

Apoptosis Peptides

Inflammation Peptides

Cancer Peptides

Kinases Phosphatases Peptides

Miscellaneous Peptides

FRET Substrates Peptides

Immunomodulation Peptides

Enzyme Inhibitor Peptides

RGD Peptides

Neuropeptide Peptides

Peptide Analysis Services

HPLC

MS,LC-MS

MALDI-TOF

H/C/2D NMR

Elemental Analysis

Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS091010	Renin Inhibitor III	RRPFHStaIHK-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$79
KS091008	Intermedin (human)	TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15)	1188922-20-4	≥95% (HPLC)	$749
KS091003	Bradykinin	RPPGFSPFR-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$55
KS062013	Calcitonin Gene Related Peptide (human)	ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2	90954-53-3	≥95% (HPLC)	$457
KS063002	Angiotensin II (human)	DRVYIHPF-OH (trifluoroacetate Salt)	4474-91-3	≥95% (HPLC)	$49
KS091009	Intermedin (rat)	PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15)	1816940-00-7	≥95% (HPLC)	$749
KS062025	Calcitonin Gene Related Peptide (rat)	SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	96827-03-1	≥95% (HPLC)	$408
KS062001	Angiotensin Converting Enzyme Inhibitor	Glp-WPRPQIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$55
KS062008	Angiotensin I Converting Enzyme Inhibitor 3	RPGFSPFR-OH (trifluoroacetate Salt)	258279-04-8	≥95% (HPLC)	$67
KS062014	Calcitonin Gene Related Peptide II (human)	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)	98824-26-1	≥95% (HPLC)	$457
KS062021	Angiotensin III (human)	RVYIHPF-OH (trifluoroacetate Salt)	100900-06-9	≥95% (HPLC)	$48
KS091006	Adrenomedullin (1-52) (porcine)	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge)	912862-96-5	≥95% (HPLC)	$1146
KS091001	Angiotensin I Converting Enzyme Inhibitor 2	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$67
KS062018	ANP (1-28); Carperitide	SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge)	89213-87-6	≥95% (HPLC)	$346
KS092004	Angiotensin I (human)	DRVYIHPFHL-OH (trifluoroacetate Salt)	70937-97-2	≥95% (HPLC)	$58
KS062006	Angiotensin I Converting Enzyme Inhibitor 1	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	30892-86-5	≥95% (HPLC)	$67
KS091005	Adrenomedullin (1-52) (human)	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge)	148498-78-6	≥95% (HPLC)	$765
KS084006	Angiotensin I/II (1-7)	DRVYIHP-OH (trifluoroacetate Salt)	51833-78-4	≥95% (HPLC)	$42
KS091007	Copeptin (human)	ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH (trifluoroacetate Salt)	78362-34-2	≥95% (HPLC)	$321
KS091011	Hoe 140	RRP-Hyp-G-thi-S-Dtic-Oic-R-OH	130308-48-4	≥95% (HPLC)	$133

1 2

Peptides And Proteins

Home >

products >

Cardiovascular Peptides

CATALOGUE PRODUCT

Catalog Number	Product Name	Sequence	CAS NO	Purity	Price/1mg
KS091010	Renin Inhibitor III	RRPFHStaIHK-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$79
KS091008	Intermedin (human)	TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15)	1188922-20-4	≥95% (HPLC)	$749
KS091003	Bradykinin	RPPGFSPFR-OH (trifluoroacetate Salt)	N/A	≥95% (HPLC)	$55
KS062013	Calcitonin Gene Related Peptide (human)	ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2	90954-53-3	≥95% (HPLC)	$457
KS063002	Angiotensin II (human)	DRVYIHPF-OH (trifluoroacetate Salt)	4474-91-3	≥95% (HPLC)	$49
KS091009	Intermedin (rat)	PHAQLLRVGCVLGTCQVQNLSHRLWQLVRPSGRRDSAPVDPSSPHSY-NH2 (trifluoroacetate Salt) (Disulfide Bond Cys10 And Cys15)	1816940-00-7	≥95% (HPLC)	$749
KS062025	Calcitonin Gene Related Peptide (rat)	SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (trifluoroacetate Salt) (Cys2 And 7 Bridge)	96827-03-1	≥95% (HPLC)	$408
KS062001	Angiotensin Converting Enzyme Inhibitor	Glp-WPRPQIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$55
KS062008	Angiotensin I Converting Enzyme Inhibitor 3	RPGFSPFR-OH (trifluoroacetate Salt)	258279-04-8	≥95% (HPLC)	$67
KS062014	Calcitonin Gene Related Peptide II (human)	ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)	98824-26-1	≥95% (HPLC)	$457
KS062021	Angiotensin III (human)	RVYIHPF-OH (trifluoroacetate Salt)	100900-06-9	≥95% (HPLC)	$48
KS091006	Adrenomedullin (1-52) (porcine)	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge)	912862-96-5	≥95% (HPLC)	$1146
KS091001	Angiotensin I Converting Enzyme Inhibitor 2	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	35115-60-7	≥95% (HPLC)	$67
KS062018	ANP (1-28); Carperitide	SLRRSSCFGGRMDRIGAQSGLGCNSFRY-OH (Cys7 And 23 Bridge)	89213-87-6	≥95% (HPLC)	$346
KS092004	Angiotensin I (human)	DRVYIHPFHL-OH (trifluoroacetate Salt)	70937-97-2	≥95% (HPLC)	$58
KS062006	Angiotensin I Converting Enzyme Inhibitor 1	Glp-GLPPGPPIPP-OH (trifluoroacetate Salt)	30892-86-5	≥95% (HPLC)	$67
KS091005	Adrenomedullin (1-52) (human)	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (trifluoroacetate Salt) (Cys16 And 21 Bridge)	148498-78-6	≥95% (HPLC)	$765
KS084006	Angiotensin I/II (1-7)	DRVYIHP-OH (trifluoroacetate Salt)	51833-78-4	≥95% (HPLC)	$42
KS091007	Copeptin (human)	ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY-OH (trifluoroacetate Salt)	78362-34-2	≥95% (HPLC)	$321
KS091011	Hoe 140	RRP-Hyp-G-thi-S-Dtic-Oic-R-OH	130308-48-4	≥95% (HPLC)	$133

1 2

Call us

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

Address

#A2, National Health Big Data Industrial Park, Hefei, China

Asia & Pacific: 0551-65120828

sales@ks-vpeptide.com

#A2, National Health Big Data Industrial Park, Hefei, China