• RESOURCES
  • Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Neuropeptide Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS171004 Pro-Cortistatin (28-47) SALPLESGPTGQDSVQDATG-NH2 (trifluoroacetate Salt) N/A ≥95% $117
    KS171008 Pro-Cortistatin (51-81) TGLLTFLAWWHEWASQDSSSTAFEGGTPELS-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $257
    KS171009 Urocortin II (mouse) VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $313
    KS171001 Neuropeptide S SFRNGVGTGMKKTSFQRAKS-OH 412938-67-1 ≥95% (HPLC) $135
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% $64
    KS171002 Neuropeptide Y YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (trifluoroacetate Salt) 90880-35-6 ≥95% $313
    KS171003 Neurotensin Glp-LYENKPRRPYIL-OH (trifluoroacetate Salt) 55508-42-4 ≥95% $107
    KS171005 Neurokinin B DMHDFFVGLM-NH2 (trifluoroacetate Salt) 86933-75-7 ≥95% $58
    KS171006 Urocortin (human) DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 (trifluoroacetate Salt) 176591-49-4 ≥95% (HPLC) $373
    KS171007 Urocortin (rat) DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 (trifluoroacetate Salt) 171543-83-2 ≥95% (HPLC) $373
    KS171010 Urocortin III (human) FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 (trifluoroacetate Salt) 357952-09-1 ≥95% (HPLC) $313
    KS171011 Urocortin III (mouse) FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-OH (trifluoroacetate Salt) 357952-10-4 ≥95% (HPLC) $313
    KS171012 FMRF FMRF-OH (trifluoroacetate Salt) 357952-10-4 ≥95% (HPLC) $26
    KS171013 Neuromedin U (rat) YKVNEYQGPVAPSGGFFLFRPRN-NH2 (trifluoroacetate Salt) 117505-80-3 ≥95% (HPLC) $135
    1
    Products
    Peptides And Proteins
    Application scenarios cover new hot spots and valuable research fields, such as protein purification and detection, disease-related research, immunology and biochemistry research, scientific research peptides, medicinal peptides, etc., to meet the needs of researchers at different stages. We have a complete customer service system and technical team, each peptide product purified by HPLC, more stable quality, more timely delivery.
    Home >

    products >

    Neuropeptide Peptides

    Peptide for scientific research refers to a customized synthetic peptide can screen preclinical candidate compounds. KS-V is continuously expanding and updating its extensive range of biologically active peptides in different applications, especially on development of disease-related scientific peptide products.
    Catalog Number Product Name Sequence CAS NO Purity Price/1mg
    KS171004 Pro-Cortistatin (28-47) SALPLESGPTGQDSVQDATG-NH2 (trifluoroacetate Salt) N/A ≥95% $117
    KS171008 Pro-Cortistatin (51-81) TGLLTFLAWWHEWASQDSSSTAFEGGTPELS-OH (trifluoroacetate Salt) N/A ≥95% (HPLC) $257
    KS171009 Urocortin II (mouse) VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 (trifluoroacetate Salt) N/A ≥95% (HPLC) $313
    KS171001 Neuropeptide S SFRNGVGTGMKKTSFQRAKS-OH 412938-67-1 ≥95% (HPLC) $135
    KS063011 Substance P RPKPQQFFGLM-NH2 (trifluoroacetate Salt) 33507-63-0 ≥95% $64
    KS171002 Neuropeptide Y YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (trifluoroacetate Salt) 90880-35-6 ≥95% $313
    KS171003 Neurotensin Glp-LYENKPRRPYIL-OH (trifluoroacetate Salt) 55508-42-4 ≥95% $107
    KS171005 Neurokinin B DMHDFFVGLM-NH2 (trifluoroacetate Salt) 86933-75-7 ≥95% $58
    KS171006 Urocortin (human) DNPSLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 (trifluoroacetate Salt) 176591-49-4 ≥95% (HPLC) $373
    KS171007 Urocortin (rat) DDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV-NH2 (trifluoroacetate Salt) 171543-83-2 ≥95% (HPLC) $373
    KS171010 Urocortin III (human) FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 (trifluoroacetate Salt) 357952-09-1 ≥95% (HPLC) $313
    KS171011 Urocortin III (mouse) FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-OH (trifluoroacetate Salt) 357952-10-4 ≥95% (HPLC) $313
    KS171012 FMRF FMRF-OH (trifluoroacetate Salt) 357952-10-4 ≥95% (HPLC) $26
    KS171013 Neuromedin U (rat) YKVNEYQGPVAPSGGFFLFRPRN-NH2 (trifluoroacetate Salt) 117505-80-3 ≥95% (HPLC) $135
    1