Products
products details
Home > Products >
Beta β-Secretase Substrate I Alzheimer's Peptide (MCA-DNP Pair)

Beta β-Secretase Substrate I Alzheimer's Peptide (MCA-DNP Pair)

Product Details:
Catalog Number:
KS012004
Product Name:
β-Secretase Substrate I (MCA-DNP Pair)
Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
CAS NO.:
N/A
Price/1mg:
$219
Purity:
≥95% (HPLC)
Molecular Formula:
C66H86N14O23S1
Molecular Weight:
1463.52
Form:
Lyophilized
Storage:
Store At -20°C Or -80°C
High Light: 

Beta Secretase Alzheimer's Peptide

,

β secretase Alzheimer's Peptide

,

β secretase Substrate

Product Description

β-Secretase Substrate I (MCA-DNP pair),Catalog Number: KS012004,Molecular Weight:1463.52

 

MCA-HQKLVFFA-K(DNP)-NH2 is a fluorogenic substrate for α-secretase. Upon cleavage by α-secretase, 7-methoxycoumarin-4-acetyl (MCA) is released and its fluorescence can be used to quantify α-secretase activity. MCA displays excitation and emission maxima at 328 and 420 nm, respectively.

 

Main Sales Markets: North America,Central/South America,Western Europe,Eastern Europe,Australia,Asia,Middle East,Africa

 

Products
products details
Home > Products >
Beta β-Secretase Substrate I Alzheimer's Peptide (MCA-DNP Pair)

Beta β-Secretase Substrate I Alzheimer's Peptide (MCA-DNP Pair)

Product Details:
Catalog Number:
KS012004
Product Name:
β-Secretase Substrate I (MCA-DNP Pair)
Sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
CAS NO.:
N/A
Price/1mg:
$219
Purity:
≥95% (HPLC)
Molecular Formula:
C66H86N14O23S1
Molecular Weight:
1463.52
Form:
Lyophilized
Storage:
Store At -20°C Or -80°C
Details Link:
Https://shopping.ks-vpeptide.com/sale-470427-beta-secretase-substrate-i-alzheimer-s-peptide-mca-dnp-pair.htm
High Light: 

Beta Secretase Alzheimer's Peptide

,

β secretase Alzheimer's Peptide

,

β secretase Substrate

Product Description

β-Secretase Substrate I (MCA-DNP pair),Catalog Number: KS012004,Molecular Weight:1463.52

 

MCA-HQKLVFFA-K(DNP)-NH2 is a fluorogenic substrate for α-secretase. Upon cleavage by α-secretase, 7-methoxycoumarin-4-acetyl (MCA) is released and its fluorescence can be used to quantify α-secretase activity. MCA displays excitation and emission maxima at 328 and 420 nm, respectively.

 

Main Sales Markets: North America,Central/South America,Western Europe,Eastern Europe,Australia,Asia,Middle East,Africa