Products
products details
Home > Products >
CGRP Calcitonin Gene Related Peptide II (Human) Catalog KS091002 CAS 98824-26-1

CGRP Calcitonin Gene Related Peptide II (Human) Catalog KS091002 CAS 98824-26-1

Product Details:
Catalog Number:
KS091002
Product Name:
Calcitonin Gene Related Peptide II (human)
Sequence:
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)
CAS NO.:
98824-26-1
Price/1mg:
$370
Purity:
≥95% (HPLC)
Molecular Formula:
C109H159N25O32S5
Molecular Weight:
2492
Form:
Lyophilized
Storage:
Store At -20°C Or -80°C
High Light: 

calcitonin gene related peptide KS091002

,

calcitonin gene related peptide II

,

cgrp peptide II

Product Description

Calcitonin Gene Related Peptide II (human),Catalog Number: KS091002,CAS NO.: 98824-26-1

 

Endothelin 1 (human, porcine) is an endogenous potent vasoconstrictor peptide that is an agonist at ETA and ETB receptors. Modulates vascular tone.

Products
products details
Home > Products >
CGRP Calcitonin Gene Related Peptide II (Human) Catalog KS091002 CAS 98824-26-1

CGRP Calcitonin Gene Related Peptide II (Human) Catalog KS091002 CAS 98824-26-1

Product Details:
Catalog Number:
KS091002
Product Name:
Calcitonin Gene Related Peptide II (human)
Sequence:
ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFNH2 (trifluoroacetate Salt)
CAS NO.:
98824-26-1
Price/1mg:
$370
Purity:
≥95% (HPLC)
Molecular Formula:
C109H159N25O32S5
Molecular Weight:
2492
Form:
Lyophilized
Storage:
Store At -20°C Or -80°C
Details Link:
Https://shopping.ks-vpeptide.com/sale-470558-cgrp-calcitonin-gene-related-peptide-ii-human-catalog-ks091002-cas-98824-26-1.htm
High Light: 

calcitonin gene related peptide KS091002

,

calcitonin gene related peptide II

,

cgrp peptide II

Product Description

Calcitonin Gene Related Peptide II (human),Catalog Number: KS091002,CAS NO.: 98824-26-1

 

Endothelin 1 (human, porcine) is an endogenous potent vasoconstrictor peptide that is an agonist at ETA and ETB receptors. Modulates vascular tone.