Leave a Message
We will call you back soon!
Your message must be between 20-3,000 characters!
Please check your E-mail!
SUBMIT
|
Margatoxin,CAS#:145808-47-5,Catalog Number:K1020-V,Store at -20°C or -80°C
Kv1.3 selective blocker
Margatoxin (MgTX) is a peptide that selectively inhibits Kv1.3 voltage-dependent potassium channels. It is found in the venom of Centruroides margaritatus, also known as the Central American Bark Scorpion. Margatoxin was first discovered in 1993. It was purified from scorpion venom and its amino acid sequence was determined.
Structure
Margatoxin is a peptide of 39 amino acids with a molecular weight of 4185 Dalton. The primary amino acid sequence of margatoxin is as follows:
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His
Or, when translated to one-letter sequence,
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH.
There are disulfide bridges between Cys7-Cys29, Cys13-Cys34 and Cys17-Cys36.
Margatoxin is classified as a "scorpion short toxin" by Pfam, showing sequence homology with other potassium channel blockers, such as charybdotoxin (44%), kaliotoxin (54%), iberiotoxin (41%) and noxiustoxin (79%), which are also derived from scorpion venom.
|
|
Margatoxin,CAS#:145808-47-5,Catalog Number:K1020-V,Store at -20°C or -80°C
Kv1.3 selective blocker
Margatoxin (MgTX) is a peptide that selectively inhibits Kv1.3 voltage-dependent potassium channels. It is found in the venom of Centruroides margaritatus, also known as the Central American Bark Scorpion. Margatoxin was first discovered in 1993. It was purified from scorpion venom and its amino acid sequence was determined.
Structure
Margatoxin is a peptide of 39 amino acids with a molecular weight of 4185 Dalton. The primary amino acid sequence of margatoxin is as follows:
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His
Or, when translated to one-letter sequence,
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH.
There are disulfide bridges between Cys7-Cys29, Cys13-Cys34 and Cys17-Cys36.
Margatoxin is classified as a "scorpion short toxin" by Pfam, showing sequence homology with other potassium channel blockers, such as charybdotoxin (44%), kaliotoxin (54%), iberiotoxin (41%) and noxiustoxin (79%), which are also derived from scorpion venom.